PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G18110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family NF-YA
Protein Properties Length: 305aa    MW: 33338 Da    PI: 9.4841
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G18110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.42.1e-32156212158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep++VNaKQy++Il+RRq Rakle+++k+  k+rkpylheSRh+hA++R+RgsgGrF
  LPERR03G18110.1 156 EEPIFVNAKQYHAILRRRQVRAKLEAQNKM-VKGRKPYLHESRHRHAMKRARGSGGRF 212
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.8E-36154215IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.727155215IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.2E-27157212IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.3E-24158180IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860160180IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.3E-24189212IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MENHPVQCMA KPNFDFLSGN GYPTKQLVQR NSDGDSSSTK SGQSHQETSA VSDNSLNGQH  60
TSAQSVFVPS DINDNDNFGK RDHGTKSALS LGNTEVAFPP SKFDYNQPFA CVSYPYATDP  120
YYGGVLTGYT SHAFVHPQIS GTANSRMPLP VEPSAEEPIF VNAKQYHAIL RRRQVRAKLE  180
AQNKMVKGRK PYLHESRHRH AMKRARGSGG RFLTKKELLE QQQKPPSESP QPPTGRARAS  240
GGAMVLGKNL CPENSTSCSP STPTGSEISS ISFGGGMLAH QEHISFSSAD HHPTMNQNHH  300
VPIIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-23156217263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1196205RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0621350.0AK062135.1 Oryza sativa Japonica Group cDNA clone:001-045-F05, full insert sequence.
GenBankEU8470110.0EU847011.1 Oryza sativa Japonica Group clone KCS132A05 CCAAT-binding transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631980.10.0PREDICTED: nuclear transcription factor Y subunit A-4
SwissprotQ93ZH22e-42NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A0D9VV690.0A0A0D9VV69_9ORYZ; Uncharacterized protein
STRINGORGLA03G0197400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.12e-38nuclear factor Y, subunit A3